PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_20550_BGI-A2_v1.0
Common NameF383_27555
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 689aa    MW: 75169.4 Da    PI: 8.5874
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_20550_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.36e-12185247163
                                 XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                      bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                 e+e kr  r+ +NRe+A+ sRqRKk ++eeLe+kv ++ +  ++L +++     e a+l++++
  Cotton_A_20550_BGI-A2_v1.0 185 EEEEKRKARLLRNRESAQLSRQRKKHYVEELEDKVRTMHSTITDLNNKIAFFMAENATLRQQL 247
                                 6899******************************************99999999999988875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001705.4E-11185247IPR004827Basic-leucine zipper domain
SMARTSM003383.9E-17185249IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.3187250IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.0E-17189248No hitNo description
SuperFamilySSF579595.7E-12189247No hitNo description
CDDcd147041.77E-20190241No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    Send to blast
MAEAPLEPQM GSELESLAIP PMDSLYLSSD LGFPLDENDD FQLTFDDFDD LYFPSDSDHL  60
IMPDSSDAPA FTSESYVERY LNSSSPGLDS FSCPNSSGNS HSPISSLGSG NCGSAASDDT  120
NVTSPDSGNN MDQKIDVEEL GKRRVSKRQK GNEETDSIKC RRSSSLLTAN NYNFNSDNKS  180
NSLSEEEEKR KARLLRNRES AQLSRQRKKH YVEELEDKVR TMHSTITDLN NKIAFFMAEN  240
ATLRQQLSTG GAGGGGAGMC PPQPVPLPMY PPVAYPWMPC GPPYMMKPPG SQVPLIPIPR  300
LKTQQQSRPA SKAKKNESKT KKVASVSVLG MLFFILMFSG LVPIMNLRYD NTPVGSGPGF  360
VGDGFYEVHR GRVLRVDSHL NRSKYSRDAA FSYGGFNISN RVHGRRSESG GERKKTGAQS  420
APDYIKNVSE PLTASLYVPR NDKLVKIDGN LIIHSVLASE KALASHKASE RKNKETGLAI  480
PKNFSPALAI PNARENGGKH SREYRNPAER PMALSSGSAD ALKDHIRSTA ADGKMQQWFR  540
EGVAGPMLSS GMCTEVFQFD ASAPGAIVPA SSVTPESAKN RQNATQLNKG RNRRILHGHP  600
VPLSRSDLNI TQEHVGRNSG NQNFQGNKTA SSMVVSVLID PREAGDGDMD DMIVPKSLSR  660
IFVVVLLDSV KYVTYSCGLP RSGLHLVTA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1580593RQNATQLNKGRNRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012462424.10.0PREDICTED: bZIP transcription factor 17
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLA0A0B0MUW00.0A0A0B0MUW0_G
STRINGVIT_08s0040g00870.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-144bZIP family protein